Lineage for d4kplg1 (4kpl G:4-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948105Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries)
  8. 2948141Domain d4kplg1: 4kpl G:4-113 [266571]
    Other proteins in same PDB: d4kpla2, d4kpla3, d4kplb2, d4kplb3, d4kplc2, d4kplc3, d4kpld2, d4kpld3, d4kple2, d4kple3, d4kplf2, d4kplf3, d4kplg2, d4kplg3, d4kplh2, d4kplh3
    automated match to d4il2a1
    complexed with cl, cs2, gol, kdg, mg

Details for d4kplg1

PDB Entry: 4kpl (more details), 2 Å

PDB Description: Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg,d-mannonate and 2-keto-3-deoxy-d-gluconate
PDB Compounds: (G:) D-mannonate dehydratase

SCOPe Domain Sequences for d4kplg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kplg1 d.54.1.0 (G:4-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d4kplg1:

Click to download the PDB-style file with coordinates for d4kplg1.
(The format of our PDB-style files is described here.)

Timeline for d4kplg1: