Lineage for d4kkfa_ (4kkf A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1742883Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 1743106Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 1743107Protein automated matches [190108] (11 species)
    not a true protein
  7. 1743116Species Clostridium cellulovorans [TaxId:1493] [256855] (6 PDB entries)
  8. 1743117Domain d4kkfa_: 4kkf A: [266556]
    automated match to d1l1ya_
    complexed with ca, cbi, cbk

Details for d4kkfa_

PDB Entry: 4kkf (more details), 1.7 Å

PDB Description: complex structure of catalytic domain of clostridium cellulovorans exgs and cellobiose
PDB Compounds: (A:) Exoglucanase S

SCOPe Domain Sequences for d4kkfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkfa_ a.102.1.0 (A:) automated matches {Clostridium cellulovorans [TaxId: 1493]}
vpnneyvqhfkdmyakihnanngyfsdegipyhavetlmveapdyghettseafsyymwl
eamnakltgdfsgfkkawdvtekyiipgetdqpsasmsnydpnkpatyaaehpdpsmyps
qlqfgaavgkdplynelkstygtsqvygmhwlldvdnwygfggatstspvyintfqrgvq
escwetvpqpckdemkyggrngfldlftgdsqyatqfkytnapdadaravqatyyaqlaa
kewgvdissyvakstkmgdflrysffdkyfrkvgnstqagtgydsaqyllnwyyawgggi
ssnwswrigsshnhfgyqnpmaawilsntsdfkpkspnaatdwnnslkrqiefyqwlqsa
eggiaggasnsnggsyqawpagtrtfygmgytphpvyedpgsnewfgmqawsmqrvaeyy
ysskdpaakslldkwakwacanvqfddaakkfkipaklvwtgqpdtwtgsytgnsnlhvk
veaygedlgvagslsnalsyyakalesstdaadkvayntaketsrkildylwasyqddkg
iavtetrndfkrfnqsvyipsgwtgkmpngdviqsgatflsirskykqdpswpnveaala
ngtgvdmtyhrfwgqsdiaiafgtygtlft

SCOPe Domain Coordinates for d4kkfa_:

Click to download the PDB-style file with coordinates for d4kkfa_.
(The format of our PDB-style files is described here.)

Timeline for d4kkfa_:

  • d4kkfa_ is new in SCOPe 2.05-stable
  • d4kkfa_ does not appear in SCOPe 2.06