SCOPe 2.06: Domain d4kb1b_: 4kb1 B:

Lineage for d4kb1b_ (4kb1 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein automated matches [190162] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187263] (14 PDB entries)

8. Domain d4kb1b_: 4kb1 B: [266544]
   automated match to d3nh1a_
   protein/DNA complex; complexed with mg

Details for d4kb1b_

PDB Entry: 4kb1, 1.8 Å

PDB Description: Crystal structure of RNase T in complex with a bluge DNA (two nucleotide insertion CT )

PDB Compounds: (B:) Ribonuclease T

SCOPe Domain Sequences for d4kb1b_:

Sequence; same for both SEQRES and ATOM records:

>d4kb1b_ c.55.3.5 (B:) automated matches {Escherichia coli [TaxId: 562]}
ltglcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfv
ganlqpealafngidpndpdrgavseyealheifkvvrkgikasgcnraimvahnanfdh
sfmmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalyd
tertavlfceivnrwkrlggwplsa

Timeline for d4kb1b_:

• d4kb1b_ first appeared in SCOPe 2.05
  
• d4kb1b_ appears in SCOPe 2.07
  
• d4kb1b_ appears in the current release, SCOPe 2.08