SCOPe 2.06: Domain d4k8ga2: 4k8g A:112-402

Lineage for d4k8ga2 (4k8g A:112-402)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (74 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:279238] [267959] (3 PDB entries)

8. Domain d4k8ga2: 4k8g A:112-402 [266539]
   Other proteins in same PDB: d4k8ga1, d4k8ga3
   automated match to d4il2a2
   complexed with gol, mg; mutant

Details for d4k8ga2

PDB Entry: 4k8g, 1.25 Å

PDB Description: crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans mutant (v161a, r163a, k165g, l166a, y167g, y168a, e169g)

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d4k8ga2:

Sequence, based on SEQRES records:

>d4k8ga2 c.1.11.0 (A:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgikdaygagaggagagpa
daslpsvtgwdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyq
lfwledctpaenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagg
lthlrriadlaslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavf
phdywfekgelfvgetpghgvdideelaakypykpaylpvarledgtmwnw

Sequence, based on observed residues (ATOM records):

>d4k8ga2 c.1.11.0 (A:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgikslpsvtgwdtrkaln
yvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafr
lvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriadlaslyqvr
tgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetp
ghgvdideelaakypykpaylpvarledgtmwnw

Timeline for d4k8ga2:

• d4k8ga2 first appeared in SCOPe 2.05
  
• d4k8ga2 appears in SCOPe 2.07
  
• d4k8ga2 appears in the current release, SCOPe 2.08