Lineage for d4k8ga1 (4k8g A:1-111)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948365Species Novosphingobium aromaticivorans [TaxId:279238] [267958] (3 PDB entries)
  8. 2948366Domain d4k8ga1: 4k8g A:1-111 [266538]
    Other proteins in same PDB: d4k8ga2, d4k8ga3
    automated match to d4il2a1
    complexed with gol, mg; mutant

Details for d4k8ga1

PDB Entry: 4k8g (more details), 1.25 Å

PDB Description: crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans mutant (v161a, r163a, k165g, l166a, y167g, y168a, e169g)
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d4k8ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k8ga1 d.54.1.0 (A:1-111) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllgg

SCOPe Domain Coordinates for d4k8ga1:

Click to download the PDB-style file with coordinates for d4k8ga1.
(The format of our PDB-style files is described here.)

Timeline for d4k8ga1: