Lineage for d4k4ab_ (4k4a B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2511612Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2511613Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2511928Family d.38.1.5: PaaI/YdiI-like [89902] (15 protein domains)
  6. 2511984Protein Hypothetical protein YdiI [102910] (1 species)
  7. 2511985Species Escherichia coli [TaxId:562] [102911] (6 PDB entries)
  8. 2511997Domain d4k4ab_: 4k4a B: [266517]
    automated match to d1sbka_
    complexed with 0fq

Details for d4k4ab_

PDB Entry: 4k4a (more details), 1.89 Å

PDB Description: X-ray crystal structure of E. coli YdiI complexed with phenacyl-CoA
PDB Compounds: (B:) Esterase YdiI

SCOPe Domain Sequences for d4k4ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4ab_ d.38.1.5 (B:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
ekgrlccssrlttail

SCOPe Domain Coordinates for d4k4ab_:

Click to download the PDB-style file with coordinates for d4k4ab_.
(The format of our PDB-style files is described here.)

Timeline for d4k4ab_: