Lineage for d4k49c_ (4k49 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943910Protein Hypothetical protein YdiI [102910] (1 species)
  7. 2943911Species Escherichia coli [TaxId:562] [102911] (6 PDB entries)
  8. 2943916Domain d4k49c_: 4k49 C: [266514]
    automated match to d1sbka_
    complexed with hfq

Details for d4k49c_

PDB Entry: 4k49 (more details), 1.89 Å

PDB Description: X-ray crystal structure of E. coli YdiI complexed with 2,4-dihydroxyphenacyl CoA
PDB Compounds: (C:) Esterase YdiI

SCOPe Domain Sequences for d4k49c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k49c_ d.38.1.5 (C:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
ekgrlccssrlttail

SCOPe Domain Coordinates for d4k49c_:

Click to download the PDB-style file with coordinates for d4k49c_.
(The format of our PDB-style files is described here.)

Timeline for d4k49c_: