| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
| Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
| Protein Hypothetical protein YdiI [102910] (1 species) |
| Species Escherichia coli [TaxId:562] [102911] (6 PDB entries) |
| Domain d4k49b_: 4k49 B: [266513] automated match to d1sbka_ complexed with hfq |
PDB Entry: 4k49 (more details), 1.89 Å
SCOPe Domain Sequences for d4k49b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k49b_ d.38.1.5 (B:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
ekgrlccssrlttail
Timeline for d4k49b_: