SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4k2sb1 (4k2s B:4-113)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2171206Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2171207Protein automated matches [226922] (86 species)
    not a true protein
  7. 2171412Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries)
  8. 2171425Domain d4k2sb1: 4k2s B:4-113 [266498]
    Other proteins in same PDB: d4k2sa2, d4k2sa3, d4k2sb2, d4k2sb3, d4k2sc2, d4k2sc3, d4k2sd2, d4k2sd3, d4k2se2, d4k2se3, d4k2sf2, d4k2sf3, d4k2sg2, d4k2sg3, d4k2sh2, d4k2sh3
    automated match to d4il2a1
    complexed with cl, gco, gol, mg; mutant

Details for d4k2sb1

PDB Entry: 4k2s (more details), 1.7 Å

PDB Description: Crystal structure of the mutant P317A of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
PDB Compounds: (B:) D-mannonate dehydratase

SCOPe Domain Sequences for d4k2sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k2sb1 d.54.1.0 (B:4-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d4k2sb1:

Click to download the PDB-style file with coordinates for d4k2sb1.
(The format of our PDB-style files is described here.)

Timeline for d4k2sb1: