SCOPe 2.08: Domain d4k1wa2: 4k1w A:112-402

Lineage for d4k1wa2 (4k1w A:112-402)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:279238] [267959] (3 PDB entries)

8. Domain d4k1wa2: 4k1w A:112-402 [266489]
   Other proteins in same PDB: d4k1wa1, d4k1wa3, d4k1wb1, d4k1wb3, d4k1wc1, d4k1wc3, d4k1wd1, d4k1wd3
   automated match to d4il2a2
   complexed with co2, co3, cs2, mg, pdo, pge; mutant

Details for d4k1wa2

PDB Entry: 4k1w, 1.65 Å

PDB Description: Crystal structure of the A314P mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and d-mannonate

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d4k1wa2:

Sequence, based on SEQRES records:

>d4k1wa2 c.1.11.0 (A:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepa
daslpsvtgwdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyq
lfwledctpaenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagg
lthlrriadlaslyqvrtgchgptdlspvtmgcalhfdtwvpnfgiqeymrhteetdavf
phdywfekgelfvgetpghgvdideelaakypykpaylpvarledgtmwnw

Sequence, based on observed residues (ATOM records):

>d4k1wa2 c.1.11.0 (A:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgikslpsvtgwdtrkaln
yvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafr
lvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriadlaslyqvr
tgchgptdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetp
ghgvdideelaakypykpaylpvarledgtmwnw

Timeline for d4k1wa2:

• d4k1wa2 first appeared in SCOPe 2.05
  
• d4k1wa2 appears in SCOPe 2.07