SCOPe 2.05: Domain d4jibb_: 4jib B:

Lineage for d4jibb_ (4jib B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)

8. Domain d4jibb_: 4jib B: [266482]
   automated match to d4d09c_
   complexed with 1l6, mg, zn

Details for d4jibb_

PDB Entry: 4jib, 1.72 Å

PDB Description: crystal structure of of pde2-inhibitor complex

PDB Compounds: (B:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d4jibb_:

Sequence; same for both SEQRES and ATOM records:

>d4jibb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptl
arfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdld
hrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmld
lmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwktt
rkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfp
kaaelyervasnrehwtkvshkftirglpsnnsldf

Timeline for d4jibb_:

• d4jibb_ is new in SCOPe 2.05-stable
  
• d4jibb_ appears in SCOPe 2.06
  
• d4jibb_ appears in the current release, SCOPe 2.08