SCOPe 2.08: Domain d4jhoa1: 4jho A:1-478

Lineage for d4jhoa1 (4jho A:1-478)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Oryza sativa [TaxId:39946] [267953] (5 PDB entries)

8. Domain d4jhoa1: 4jho A:1-478 [266480]
   Other proteins in same PDB: d4jhoa2
   automated match to d1cbga_
   complexed with epe, gol

Details for d4jhoa1

PDB Entry: 4jho, 2.21 Å

PDB Description: Structural analysis and insights into glycon specificity of the rice GH1 Os7BGlu26 beta-D-mannosidase

PDB Compounds: (A:) Beta-mannosidase/beta-glucosidase

SCOPe Domain Sequences for d4jhoa1:

Sequence; same for both SEQRES and ATOM records:

>d4jhoa1 c.1.8.0 (A:1-478) automated matches {Oryza sativa [TaxId: 39946]}
ywlnpeiydagglsrrafpegfvfgtaasayqvegmakqggrgpsiwdafiekpgtipnn
atadvtvdeyhrykedvnimknmgfdayrfsiswsrifpngtgmvnqegvdyynrlidym
vkkgikpyanlyhydlplalheqylgwlspniveafadyadfcfqtfgdrvkdwftfnep
rcvaalgydngfhapgrcsgcdaggnsttepylaahhlilshaaavkryrekyqlyqkgr
igilldfvwyepfsdsnadraaaqrardfhlgwfldpiihgrypysmleivkdrmptfsd
eesrmvkdsidyvginhytsfymkdpgpwnltptsyqddwhvgfayerngvpigaqansy
wlyivpwginkavtyvketygnptmilsengmdqpgnvsitqgvhdtvriryyrnyitel
kkaiddgakvigyfawslldnfewrlgytsrfgivyvdyktlkrypkdsafwfknmls

Timeline for d4jhoa1:

• d4jhoa1 first appeared in SCOPe 2.05, called d4jhoa_
  
• d4jhoa1 appears in SCOPe 2.07