Lineage for d4isyc1 (4isy C:2-390)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132697Species Mycobacterium tuberculosis [TaxId:1773] [225404] (27 PDB entries)
  8. 2132742Domain d4isyc1: 4isy C:2-390 [266466]
    Other proteins in same PDB: d4isya2, d4isyb2, d4isyc2, d4isyd2
    automated match to d4r5fa_
    complexed with gol, so4

Details for d4isyc1

PDB Entry: 4isy (more details), 2.59 Å

PDB Description: Crystal structure of IscS from Mycobacterium tuberculosis
PDB Compounds: (C:) Cysteine desulfurase

SCOPe Domain Sequences for d4isyc1:

Sequence, based on SEQRES records: (download)

>d4isyc1 c.67.1.0 (C:2-390) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ayldhaattpmhpaaieamaavqrtignasslhtsgrsarrrieeareliadklgarpse
viftaggtesdnlavkgiywarrdaephrrrivttevehhavldsvnwlvehegahvtwl
ptaadgsvsatalrealqshddvalvsvmwannevgtilpiaemsvvamefgvpmhsdai
qavgqlpldfgasglsamsvaghkfggppgvgalllrrdvtcvplmhgggqerdirsgtp
dvasavgmataaqiavdgleensarlrllrdrlvegvlaeiddvclngaddpmrlagnah
ftfrgcegdallmlldangiecstgsactagvaqpshvliamgvdaasargslrlslght
sveadvdaalevlpgavararraalaaag

Sequence, based on observed residues (ATOM records): (download)

>d4isyc1 c.67.1.0 (C:2-390) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ayldhaattpmhpaaieamaavqrtignasslhtsgrsarrrieeareliadklgarpse
viftaggtesdnlavkgiywarrdaephrrrivttevehhavldsvnwlvehegahvtwl
ptaadgsvsatalrealqshddvalvsvmwannevgtilpiaemsvvamefgvpmhsdai
qavgqlpldfgasglsamsvaghkfggppgvgalllrrdvtcvplmhgggqerdirsgtp
dvasavgmataaqiavdgleensarlrllrdrlvegvlaeiddvclngaddpmrlagnah
ftfrgcegdallmlldangiecstgsapshvliamgvdaasargslrlslghtsveadvd
aalevlpgavararraalaaag

SCOPe Domain Coordinates for d4isyc1:

Click to download the PDB-style file with coordinates for d4isyc1.
(The format of our PDB-style files is described here.)

Timeline for d4isyc1:

  • d4isyc1 first appeared in SCOPe 2.05, called d4isyc_