Lineage for d4infd_ (4inf D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096081Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2096704Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2096705Protein automated matches [190150] (26 species)
    not a true protein
  7. 2096818Species Novosphingobium aromaticivorans [TaxId:279238] [267952] (6 PDB entries)
  8. 2096826Domain d4infd_: 4inf D: [266461]
    automated match to d3s4ta_
    complexed with ca, cl, gol, oxd

Details for d4infd_

PDB Entry: 4inf (more details), 1.48 Å

PDB Description: crystal structure of amidohydrolase saro_0799 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 with bound calcium
PDB Compounds: (D:) metal-dependent hydrolase

SCOPe Domain Sequences for d4infd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4infd_ c.1.9.0 (D:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
dlktggeqgylriateeafatreiidvylrmirdgtadkgmvslwgfyaqspseratqil
erlldlgerriadmdatgidkailaltspgvqplhdldeartlatrandtladacqkypd
rfigmgtvapqdpewsareihrgarelgfkgiqinshtqgryldeeffdpifralvevdq
plyihpatspdsmidpmleagldgaifgfgvetgmhllrlitigifdkypslqimvghmg
ealpywlyrldymhqagvrsqryermkplkktiegylksnvlvtnsgvawepaikfcqqv
mgedrvmyamdypyqyvadevramdamdmsaqtkkkffqtnaekwfkl

SCOPe Domain Coordinates for d4infd_:

Click to download the PDB-style file with coordinates for d4infd_.
(The format of our PDB-style files is described here.)

Timeline for d4infd_: