SCOPe 2.06: Domain d4infb_: 4inf B:

Lineage for d4infb_ (4inf B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (26 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:279238] [267952] (6 PDB entries)

8. Domain d4infb_: 4inf B: [266459]
   automated match to d3s4ta_
   complexed with ca, cl, gol, oxd

Details for d4infb_

PDB Entry: 4inf, 1.48 Å

PDB Description: crystal structure of amidohydrolase saro_0799 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 with bound calcium

PDB Compounds: (B:) metal-dependent hydrolase

SCOPe Domain Sequences for d4infb_:

Sequence; same for both SEQRES and ATOM records:

>d4infb_ c.1.9.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
qdlktggeqgylriateeafatreiidvylrmirdgtadkgmvslwgfyaqspseratqi
lerlldlgerriadmdatgidkailaltspgvqplhdldeartlatrandtladacqkyp
drfigmgtvapqdpewsareihrgarelgfkgiqinshtqgryldeeffdpifralvevd
qplyihpatspdsmidpmleagldgaifgfgvetgmhllrlitigifdkypslqimvghm
gealpywlyrldymhqagvrsqryermkplkktiegylksnvlvtnsgvawepaikfcqq
vmgedrvmyamdypyqyvadevramdamdmsaqtkkkffqtnaekwfkl

Timeline for d4infb_:

• d4infb_ first appeared in SCOPe 2.05
  
• d4infb_ appears in SCOPe 2.07
  
• d4infb_ appears in the current release, SCOPe 2.08