![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
![]() | Protein D-mannonate dehydratase [267664] (1 species) |
![]() | Species Escherichia coli [TaxId:199310] [267747] (1 PDB entry) |
![]() | Domain d4il2b2: 4il2 B:123-415 [266443] Other proteins in same PDB: d4il2a1, d4il2b1, d4il2c1, d4il2d1 complexed with mg |
PDB Entry: 4il2 (more details), 1.95 Å
SCOPe Domain Sequences for d4il2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il2b2 c.1.11.2 (B:123-415) D-mannonate dehydratase {Escherichia coli [TaxId: 199310]} asregvmvychttghsidealddyarhqelgfkairvqcgipgmkttygmskgkglayep atkgqwpeeqlwstekyldfmpklfdavrnkfgfdehllhdmhhrltpieaarfgksied yrmfwmedptpaenqecfrlirqhtvtpiavgevfnsiwdckqlieeqlidyirttltha ggitgmrriadfaslyqvrtgshgpsdlspvcmaaalhfdlwvpnfgvqeymgyseqmle vfphnwtfdngymhpgekpglgiefdeklaakypyepaylpvarledgtlwnw
Timeline for d4il2b2: