Lineage for d4il2a1 (4il2 A:13-122)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554473Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2554518Protein D-mannonate dehydratase [267663] (1 species)
  7. 2554519Species Escherichia coli [TaxId:199310] [267746] (1 PDB entry)
  8. 2554520Domain d4il2a1: 4il2 A:13-122 [266440]
    Other proteins in same PDB: d4il2a2, d4il2b2, d4il2c2, d4il2d2
    complexed with mg

Details for d4il2a1

PDB Entry: 4il2 (more details), 1.95 Å

PDB Description: crystal structure of d-mannonate dehydratase (rspa) from e. coli cft073 (efi target efi-501585)
PDB Compounds: (A:) Starvation sensing protein rspA

SCOPe Domain Sequences for d4il2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il2a1 d.54.1.1 (A:13-122) D-mannonate dehydratase {Escherichia coli [TaxId: 199310]}
kivkaevfvtcpgrnfvtlkittedgitglgdatlngrelsvasylqdhlcpqligrdah
riediwqffykgaywrrgpvtmsaisavdmalwdikakaanmplyqllgg

SCOPe Domain Coordinates for d4il2a1:

Click to download the PDB-style file with coordinates for d4il2a1.
(The format of our PDB-style files is described here.)

Timeline for d4il2a1: