Lineage for d1a9ma_ (1a9m A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 955289Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 955305Protein Human immunodeficiency virus type 1 protease [50632] (5 species)
  7. 955367Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (378 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 955991Domain d1a9ma_: 1a9m A: [26642]
    complexed with u0e; mutant

Details for d1a9ma_

PDB Entry: 1a9m (more details), 2.3 Å

PDB Description: g48h mutant of hiv-1 protease in complex with a peptidic inhibitor u- 89360e
PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d1a9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9ma_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmihgiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d1a9ma_:

Click to download the PDB-style file with coordinates for d1a9ma_.
(The format of our PDB-style files is described here.)

Timeline for d1a9ma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a9mb_