SCOP 1.55: Domain d1a9ma_: 1a9m A:

Lineage for d1a9ma_ (1a9m A:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)

8. Domain d1a9ma_: 1a9m A: [26642]

Details for d1a9ma_

PDB Entry: 1a9m, 2.3 Å

PDB Description: g48h mutant of hiv-1 protease in complex with a peptidic inhibitor u- 89360e

SCOP Domain Sequences for d1a9ma_:

Sequence; same for both SEQRES and ATOM records:

>d1a9ma_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmihgiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1a9ma_:

• d1a9ma_ appears in SCOP 1.57
  
• d1a9ma_ appears in the current release, SCOPe 2.08