Lineage for d4ihce1 (4ihc E:3-116)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554473Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2554660Protein Mandelate racemase [54838] (3 species)
  7. 2554666Species Dickeya dadantii [TaxId:579405] [267742] (1 PDB entry)
  8. 2554671Domain d4ihce1: 4ihc E:3-116 [266419]
    Other proteins in same PDB: d4ihca2, d4ihcb2, d4ihcc2, d4ihcd2, d4ihce2, d4ihcf2, d4ihcg2, d4ihch2
    complexed with cl, fmt, gol, iod, mg

Details for d4ihce1

PDB Entry: 4ihc (more details), 2 Å

PDB Description: Crystal structure of probable mannonate dehydratase Dd703_0947 (target EFI-502222) from Dickeya dadantii Ech703
PDB Compounds: (E:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d4ihce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ihce1 d.54.1.1 (E:3-116) Mandelate racemase {Dickeya dadantii [TaxId: 579405]}
klkitnvktiltapggidlavvkvetnepglyglgcatftqrifavksaideymapflig
kdptriediwqsaavsgywrngpimnnalsgvdmalwdikgklagmpvyellgg

SCOPe Domain Coordinates for d4ihce1:

Click to download the PDB-style file with coordinates for d4ihce1.
(The format of our PDB-style files is described here.)

Timeline for d4ihce1: