SCOPe 2.07: Domain d4if6a1: 4if6 A:234-510

Lineage for d4if6a1 (4if6 A:234-510)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries)

8. Domain d4if6a1: 4if6 A:234-510 [266410]
   Other proteins in same PDB: d4if6a2
   automated match to d4i5ia_
   complexed with apr, zn

Details for d4if6a1

PDB Entry: 4if6, 2.25 Å

PDB Description: Structure of NAD-dependent protein deacetylase sirtuin-1 (closed state, 2.25 A)

PDB Compounds: (A:) NAD-dependent protein deacetylase sirtuin-1

SCOPe Domain Sequences for d4if6a1:

Sequence; same for both SEQRES and ATOM records:

>d4if6a1 c.31.1.0 (A:234-510) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkrkdintiedavkllqeckkiivltgagvsvscgipdfrsrdgiyarlavdfpdlpdp
qamfdieyfrkdprpffkfakeiypgqfqpslchkfialsdkegkllrnytqnidtleqv
agiqriiqchgsfatasclickykvdceavrgdifnqvvprcprcpadeplaimkpeivf
fgenlpeqfhramkydkdevdllivigsslkvrpvalipssiphevpqilinreplphlh
fdvellgdcdviinelchrlggeyaklccnpvklsei

Timeline for d4if6a1:

• d4if6a1 first appeared in SCOPe 2.05, called d4if6a_
  
• d4if6a1 appears in SCOPe 2.06
  
• d4if6a1 appears in the current release, SCOPe 2.08