Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries) |
Domain d4if6a1: 4if6 A:234-510 [266410] Other proteins in same PDB: d4if6a2 automated match to d4i5ia_ complexed with apr, zn |
PDB Entry: 4if6 (more details), 2.25 Å
SCOPe Domain Sequences for d4if6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4if6a1 c.31.1.0 (A:234-510) automated matches {Human (Homo sapiens) [TaxId: 9606]} rkkrkdintiedavkllqeckkiivltgagvsvscgipdfrsrdgiyarlavdfpdlpdp qamfdieyfrkdprpffkfakeiypgqfqpslchkfialsdkegkllrnytqnidtleqv agiqriiqchgsfatasclickykvdceavrgdifnqvvprcprcpadeplaimkpeivf fgenlpeqfhramkydkdevdllivigsslkvrpvalipssiphevpqilinreplphlh fdvellgdcdviinelchrlggeyaklccnpvklsei
Timeline for d4if6a1: