Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Leptospira interrogans [TaxId:267671] [267949] (1 PDB entry) |
Domain d4hzib_: 4hzi B: [266376] automated match to d3gfoa_ complexed with so4 |
PDB Entry: 4hzi (more details), 1.85 Å
SCOPe Domain Sequences for d4hzib_:
Sequence, based on SEQRES records: (download)
>d4hzib_ c.37.1.0 (B:) automated matches {Leptospira interrogans [TaxId: 267671]} nsllslekisykptgktildsvsfeiktnehcvllgrngagkstlvnliygmiwatsgti rlfqetygeiaiqdlrkrigildssqqensiqrkltvkdtiltglfhtigyyrdpspeee tktlqilkdsdllskkdqlyntlssgekkkilflrsivnepdflimdepcssldltared flgflkeyhskkkftslyithrpeeipdfyskavllkegkvihfgpieecfteknledly diplqvqrientwsvipkq
>d4hzib_ c.37.1.0 (B:) automated matches {Leptospira interrogans [TaxId: 267671]} nsllslekisykptgktildsvsfeiktnehcvllgrngagkstlvnliygmiwatsgti rlfqetygeiaiqdlrkrigildssqrkltvkdtiltgldpspeeetktlqilkdsdlls kkdqlyntlssgekkkilflrsivnepdflimdepcssldltaredflgflkeyhskkkf tslyithrpeeipdfyskavllkegkvihfgpieecfteknledlydiplqvqrientws vipkq
Timeline for d4hzib_: