Lineage for d4hzia_ (4hzi A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114428Species Leptospira interrogans [TaxId:267671] [267949] (1 PDB entry)
  8. 2114429Domain d4hzia_: 4hzi A: [266375]
    automated match to d3gfoa_
    complexed with so4

Details for d4hzia_

PDB Entry: 4hzi (more details), 1.85 Å

PDB Description: Crystal structure of the Leptospira interrogans ATPase subunit of an orphan ABC transporter
PDB Compounds: (A:) ABC transporter ATP-binding protein

SCOPe Domain Sequences for d4hzia_:

Sequence, based on SEQRES records: (download)

>d4hzia_ c.37.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 267671]}
nsllslekisykptgktildsvsfeiktnehcvllgrngagkstlvnliygmiwatsgti
rlfqetygeiaiqdlrkrigildssqqensiqrkltvkdtiltglfhtigyyrdpspeee
tktlqilkdsdllskkdqlyntlssgekkkilflrsivnepdflimdepcssldltared
flgflkeyhskkkftslyithrpeeipdfyskavllkegkvihfgpieecfteknledly
diplqvqrientwsvipkq

Sequence, based on observed residues (ATOM records): (download)

>d4hzia_ c.37.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 267671]}
nsllslekisykptgktildsvsfeiktnehcvllgrngagkstlvnliygmiwatsgti
rlfqetygeiaiqdlrkrigildssqrkltvkdtiltglfhtigyyrdpspeeetktlqi
lkdsdllskkdqlyntlssgekkkilflrsivnepdflimdepcssldltaredflgflk
eyhskkkftslyithrpeeipdfyskavllkegkvihfgpieecfteknledlydiplqv
qrientwsvipkq

SCOPe Domain Coordinates for d4hzia_:

Click to download the PDB-style file with coordinates for d4hzia_.
(The format of our PDB-style files is described here.)

Timeline for d4hzia_: