Lineage for d4hz2b2 (4hz2 B:80-205)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714330Species Xanthobacter autotrophicus [TaxId:78245] [267948] (1 PDB entry)
  8. 2714332Domain d4hz2b2: 4hz2 B:80-205 [266374]
    Other proteins in same PDB: d4hz2a1, d4hz2a3, d4hz2b1, d4hz2b3
    automated match to d3m3ma2
    complexed with bez, gsh, unl

Details for d4hz2b2

PDB Entry: 4hz2 (more details), 1.5 Å

PDB Description: crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
PDB Compounds: (B:) Glutathione S-transferase domain

SCOPe Domain Sequences for d4hz2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hz2b2 a.45.1.0 (B:80-205) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
lpppglartrvhewlffeqyshepyiavarylkswlrqahlhearladcatrgaaaldvm
eqhlagepwlvgegptiadlalfaythraeeadfdlaqwpavlawvdrvaalpginlipp
ldeilp

SCOPe Domain Coordinates for d4hz2b2:

Click to download the PDB-style file with coordinates for d4hz2b2.
(The format of our PDB-style files is described here.)

Timeline for d4hz2b2: