SCOPe 2.08: Domain d4hz2b1: 4hz2 B:1-79

Lineage for d4hz2b1 (4hz2 B:1-79)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Xanthobacter autotrophicus [TaxId:78245] [267947] (1 PDB entry)

8. Domain d4hz2b1: 4hz2 B:1-79 [266373]
   Other proteins in same PDB: d4hz2a2, d4hz2a3, d4hz2b2, d4hz2b3
   automated match to d3m3ma1
   complexed with bez, gsh, unl

Details for d4hz2b1

PDB Entry: 4hz2, 1.5 Å

PDB Description: crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2

PDB Compounds: (B:) Glutathione S-transferase domain

SCOPe Domain Sequences for d4hz2b1:

Sequence; same for both SEQRES and ATOM records:

>d4hz2b1 c.47.1.0 (B:1-79) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
mriygmngsgncwkaaqilsltghdfewvetssgaagtrsadflalnaigkvpvvvlddg
talresnaillhfaegtpw

Timeline for d4hz2b1:

• d4hz2b1 first appeared in SCOPe 2.05
  
• d4hz2b1 appears in SCOPe 2.07