| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Xanthobacter autotrophicus [TaxId:78245] [267947] (1 PDB entry) |
| Domain d4hz2a1: 4hz2 A:1-79 [266371] Other proteins in same PDB: d4hz2a2, d4hz2a3, d4hz2b2, d4hz2b3 automated match to d3m3ma1 complexed with bez, gsh, unl |
PDB Entry: 4hz2 (more details), 1.5 Å
SCOPe Domain Sequences for d4hz2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hz2a1 c.47.1.0 (A:1-79) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
mriygmngsgncwkaaqilsltghdfewvetssgaagtrsadflalnaigkvpvvvlddg
talresnaillhfaegtpw
Timeline for d4hz2a1: