Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Enterococcus gallinarum [TaxId:565653] [267946] (1 PDB entry) |
Domain d4hnla2: 4hnl A:116-399 [266360] Other proteins in same PDB: d4hnla1 automated match to d3gy1a2 complexed with cl, gol, mg |
PDB Entry: 4hnl (more details), 1.48 Å
SCOPe Domain Sequences for d4hnla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hnla2 c.1.11.0 (A:116-399) automated matches {Enterococcus gallinarum [TaxId: 565653]} kartaipaythavadnlddlyheidrflaagyryircqlgfyggnpsqlqtpeepisgsy fdqtdymettlkmfaaikekygnqfqmlhdvherlhpnqaiqfakaaepyqlffledilp pdqshwltqlrsqsatpiatgelfnnpmewqelvknrqidfmrahvsqiggitpalklah fcdamgvriawhtpsdispvglavnthlnihlhnaaiqetielpantqsvfvgspqpkgg ffypmeksgigitfdeeaaadfpvvyrphewtqsrtpdgtlitp
Timeline for d4hnla2: