SCOPe 2.05: Domain d4hnla2: 4hnl A:116-399

Lineage for d4hnla2 (4hnl A:116-399)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Enterococcus gallinarum [TaxId:565653] [267946] (1 PDB entry)

8. Domain d4hnla2: 4hnl A:116-399 [266360]
   Other proteins in same PDB: d4hnla1
   automated match to d3gy1a2
   complexed with cl, gol, mg

Details for d4hnla2

PDB Entry: 4hnl, 1.48 Å

PDB Description: crystal structure of enolase egbg_01401 (target efi-502226) from enterococcus gallinarum eg2

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d4hnla2:

Sequence; same for both SEQRES and ATOM records:

>d4hnla2 c.1.11.0 (A:116-399) automated matches {Enterococcus gallinarum [TaxId: 565653]}
kartaipaythavadnlddlyheidrflaagyryircqlgfyggnpsqlqtpeepisgsy
fdqtdymettlkmfaaikekygnqfqmlhdvherlhpnqaiqfakaaepyqlffledilp
pdqshwltqlrsqsatpiatgelfnnpmewqelvknrqidfmrahvsqiggitpalklah
fcdamgvriawhtpsdispvglavnthlnihlhnaaiqetielpantqsvfvgspqpkgg
ffypmeksgigitfdeeaaadfpvvyrphewtqsrtpdgtlitp

Timeline for d4hnla2:

• d4hnla2 is new in SCOPe 2.05-stable
  
• d4hnla2 appears in SCOPe 2.06
  
• d4hnla2 appears in the current release, SCOPe 2.08