Lineage for d4hnkg_ (4hnk G:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2436644Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2436645Protein automated matches [190246] (57 species)
    not a true protein
  7. 2437127Species Plasmodium falciparum [TaxId:36329] [267940] (2 PDB entries)
  8. 2437141Domain d4hnkg_: 4hnk G: [266351]
    automated match to d2f6ib_
    complexed with gol

Details for d4hnkg_

PDB Entry: 4hnk (more details), 2.9 Å

PDB Description: Crystal structure of an Enzyme
PDB Compounds: (G:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4hnkg_:

Sequence, based on SEQRES records: (download)

>d4hnkg_ c.14.1.0 (G:) automated matches {Plasmodium falciparum [TaxId: 36329]}
pslllskriiflsspiyphiseqiisqllyleyeskrkpihlyinstgdidnnkiinlng
itdvisivdvinyissdvytyclgkaygiacilassgkkgyrfslknssfclnqsysiip
fnqatnieiqnkeimntkkkvieiiskntekdtnvisnvlerdkyfnadeavdfklidhi
lek

Sequence, based on observed residues (ATOM records): (download)

>d4hnkg_ c.14.1.0 (G:) automated matches {Plasmodium falciparum [TaxId: 36329]}
pslllskriiflsspiyphiseqiisqllyleyeskrkpihlyinstgdidnnkiinlng
itdvisivdvinyissdvytyclgkaygiacilassgkkgyrfslknssfclnqeiqnke
imntkkkvieiiskntekdtnvisnvlerdkyfnadeavdfklidhilek

SCOPe Domain Coordinates for d4hnkg_:

Click to download the PDB-style file with coordinates for d4hnkg_.
(The format of our PDB-style files is described here.)

Timeline for d4hnkg_: