Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily) consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit |
Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) |
Family c.123.1.0: automated matches [267628] (1 protein) not a true family |
Protein automated matches [267679] (4 species) not a true protein |
Species Escherichia coli [TaxId:83333] [267944] (1 PDB entry) |
Domain d4hl6d_: 4hl6 D: [266342] automated match to d2yima_ |
PDB Entry: 4hl6 (more details), 2.12 Å
SCOPe Domain Sequences for d4hl6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hl6d_ c.123.1.0 (D:) automated matches {Escherichia coli [TaxId: 83333]} kgpfegllvidmthvlngpfgtqllcnmgarvikveppghgddtrtfgpyvdgqslyysf inhgkesvvldlkndhdksifinmlkqadvlaenfrpgtmeklgfswetlqeinprliya sssgfghtgplkdapaydtiiqamsgimmetgypdappvrvgtsladlcggvylfsgivs alygreksqrgahvdiamfdatlsflehglmayiatgkspqrlgnrhpymapfdvfntqd kpiticcgndklfsalcqaleltelvndprfssnilrvqnqailkqyiertlktqaaevw larihevgvpvapllsvaeaiklpqtqarnmlieaggimmpgnpikisgcadphvmpgaa tldqhgeqirqefs
Timeline for d4hl6d_: