Lineage for d4hl6d_ (4hl6 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922183Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2922184Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2922277Family c.123.1.0: automated matches [267628] (1 protein)
    not a true family
  6. 2922278Protein automated matches [267679] (4 species)
    not a true protein
  7. 2922286Species Escherichia coli [TaxId:83333] [267944] (1 PDB entry)
  8. 2922290Domain d4hl6d_: 4hl6 D: [266342]
    automated match to d2yima_

Details for d4hl6d_

PDB Entry: 4hl6 (more details), 2.12 Å

PDB Description: yfde from escherichia coli
PDB Compounds: (D:) Uncharacterized protein YfdE

SCOPe Domain Sequences for d4hl6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hl6d_ c.123.1.0 (D:) automated matches {Escherichia coli [TaxId: 83333]}
kgpfegllvidmthvlngpfgtqllcnmgarvikveppghgddtrtfgpyvdgqslyysf
inhgkesvvldlkndhdksifinmlkqadvlaenfrpgtmeklgfswetlqeinprliya
sssgfghtgplkdapaydtiiqamsgimmetgypdappvrvgtsladlcggvylfsgivs
alygreksqrgahvdiamfdatlsflehglmayiatgkspqrlgnrhpymapfdvfntqd
kpiticcgndklfsalcqaleltelvndprfssnilrvqnqailkqyiertlktqaaevw
larihevgvpvapllsvaeaiklpqtqarnmlieaggimmpgnpikisgcadphvmpgaa
tldqhgeqirqefs

SCOPe Domain Coordinates for d4hl6d_:

Click to download the PDB-style file with coordinates for d4hl6d_.
(The format of our PDB-style files is described here.)

Timeline for d4hl6d_: