SCOPe 2.08: Domain d4gr6b_: 4gr6 B:

Lineage for d4gr6b_ (4gr6 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.0: automated matches [191655] (1 protein)
   not a true family

6. Protein automated matches [191222] (3 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256275] (2 PDB entries)

8. Domain d4gr6b_: 4gr6 B: [266336]
   automated match to d4gr2a_
   complexed with edo

Details for d4gr6b_

PDB Entry: 4gr6, 2 Å

PDB Description: Crystal structure of AtRbcX2 from Arabidopsis thaliana

PDB Compounds: (B:) AtRbcX2

SCOPe Domain Sequences for d4gr6b_:

Sequence; same for both SEQRES and ATOM records:

>d4gr6b_ a.280.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tfgdvqkqivnyftykavrtvlhqlyemnppqytwfynhiitnrptdgkrflralgkesq
elaervmitrlhlygkwikkadhgkiyqeisdenlalmrerlmet

Timeline for d4gr6b_:

• d4gr6b_ first appeared in SCOPe 2.05
  
• d4gr6b_ appears in SCOPe 2.07