| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
Superfamily a.280.1: RbcX-like [158615] (2 families) ![]() |
| Family a.280.1.0: automated matches [191655] (1 protein) not a true family |
| Protein automated matches [191222] (3 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256275] (2 PDB entries) |
| Domain d4gr6b_: 4gr6 B: [266336] automated match to d4gr2a_ complexed with edo |
PDB Entry: 4gr6 (more details), 2 Å
SCOPe Domain Sequences for d4gr6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gr6b_ a.280.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tfgdvqkqivnyftykavrtvlhqlyemnppqytwfynhiitnrptdgkrflralgkesq
elaervmitrlhlygkwikkadhgkiyqeisdenlalmrerlmet
Timeline for d4gr6b_: