Lineage for d4gr6a_ (4gr6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739026Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 2739027Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 2739092Family a.280.1.0: automated matches [191655] (1 protein)
    not a true family
  6. 2739093Protein automated matches [191222] (3 species)
    not a true protein
  7. 2739101Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256275] (2 PDB entries)
  8. 2739102Domain d4gr6a_: 4gr6 A: [266335]
    automated match to d4gr2a_
    complexed with edo

Details for d4gr6a_

PDB Entry: 4gr6 (more details), 2 Å

PDB Description: Crystal structure of AtRbcX2 from Arabidopsis thaliana
PDB Compounds: (A:) AtRbcX2

SCOPe Domain Sequences for d4gr6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gr6a_ a.280.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tfgdvqkqivnyftykavrtvlhqlyemnppqytwfynhiitnrptdgkrflralgkesq
elaervmitrlhlygkwikkadhgkiyqeisdenlalmrerlme

SCOPe Domain Coordinates for d4gr6a_:

Click to download the PDB-style file with coordinates for d4gr6a_.
(The format of our PDB-style files is described here.)

Timeline for d4gr6a_: