![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily) core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains |
![]() | Superfamily b.179.1: PA14-like [254123] (4 families) ![]() |
![]() | Family b.179.1.2: GLEYA domain [254187] (2 proteins) Pfam PF10528 PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges |
![]() | Protein automated matches [254737] (2 species) not a true protein |
![]() | Species Lager yeast (Saccharomyces pastorianus) [TaxId:27292] [267943] (2 PDB entries) |
![]() | Domain d4gq7a1: 4gq7 A:26-242 [266334] Other proteins in same PDB: d4gq7a2 automated match to d4lhna_ complexed with ca, nag |
PDB Entry: 4gq7 (more details), 2.53 Å
SCOPe Domain Sequences for d4gq7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gq7a1 b.179.1.2 (A:26-242) automated matches {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} tqaclpvgsrkngmnvnfykyslqdsttysdpqymaykysdtkklgsvsgqthlsiyygp ntafwntaswssdlfgfyttptnvtvemtgyflppqtgsytfkfatvddsailsvggsia feccaqeqppitstdftingikpwdaaaptdikgstymyagyyypikivysnakalarlp vsvvlpdgtevnddfegyvysfdddlsqsnctipdps
Timeline for d4gq7a1: