Lineage for d4gpaa_ (4gpa A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913163Protein automated matches [190296] (11 species)
    not a true protein
  7. 2913193Species Norway rat (Rattus norvegicus) [TaxId:10116] [267861] (7 PDB entries)
  8. 2913205Domain d4gpaa_: 4gpa A: [266333]
    automated match to d3h5va_
    complexed with nag

Details for d4gpaa_

PDB Entry: 4gpa (more details), 2.25 Å

PDB Description: high resolution structure of the glua4 n-terminal domain (ntd)
PDB Compounds: (A:) Glutamate receptor 4

SCOPe Domain Sequences for d4gpaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpaa_ c.93.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpssvqigglfirntdqeytafrlaiflhntspnaseapfnlvphvdnietansfavtna
fcsqysrgvfaifglydkrsvhtltsfcsalhislitpsfptegesqfvlqlrpslrgal
lslldhyewncfvflydtdrgysilqaimekagqngwhvsaicvenfndvsyrqlleeld
rrqekkfvidceierlqnileqivsvgkhvkgyhyiianlgfkdislerfihgganvtgf
qlvdfntpmvtklmdrwkkldqreypgsetppkytsaltydgvlvmaetfrslrrqkidi
srrgnagdclanpaapwgqgidmertlkqvriqgltgnvqfdhygrrvnytmdvfelkst
gprkvgywndmdklvliqd

SCOPe Domain Coordinates for d4gpaa_:

Click to download the PDB-style file with coordinates for d4gpaa_.
(The format of our PDB-style files is described here.)

Timeline for d4gpaa_: