SCOPe 2.08: Domain d4gmec1: 4gme C:24-135

Lineage for d4gmec1 (4gme C:24-135)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Caulobacter crescentus [TaxId:190650] [267941] (1 PDB entry)

8. Domain d4gmec1: 4gme C:24-135 [266331]
   Other proteins in same PDB: d4gmea2, d4gmec2
   automated match to d4il2a1
   complexed with cl, co3, cs2, gol, mg

Details for d4gmec1

PDB Entry: 4gme, 2 Å

PDB Description: Crystal structure of mannonate dehydratase (target EFI-502209) from caulobacter crescentus cb15 complexed with magnesium and d-mannonate

PDB Compounds: (C:) Mandelate racemase/muconate lactonizing enzyme family

SCOPe Domain Sequences for d4gmec1:

Sequence; same for both SEQRES and ATOM records:

>d4gmec1 d.54.1.0 (C:24-135) automated matches {Caulobacter crescentus [TaxId: 190650]}
mlkiidakvivtcpgrnfvtlkittedgitgvgdatlngrelsvvsflqdhmvpsligrd
ahqiediwqffyrgsywrggpvamtalaavdmalwdikgkvaglpvyqllgg

Timeline for d4gmec1:

• d4gmec1 first appeared in SCOPe 2.05
  
• d4gmec1 appears in SCOPe 2.07