SCOPe 2.08: Domain d4gmea2: 4gme A:136-426

Lineage for d4gmea2 (4gme A:136-426)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Caulobacter crescentus [TaxId:190650] [267942] (1 PDB entry)

8. Domain d4gmea2: 4gme A:136-426 [266330]
   Other proteins in same PDB: d4gmea1, d4gmec1
   automated match to d4il2a2
   complexed with cl, co3, cs2, gol, mg

Details for d4gmea2

PDB Entry: 4gme, 2 Å

PDB Description: Crystal structure of mannonate dehydratase (target EFI-502209) from caulobacter crescentus cb15 complexed with magnesium and d-mannonate

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme family

SCOPe Domain Sequences for d4gmea2:

Sequence; same for both SEQRES and ATOM records:

>d4gmea2 c.1.11.0 (A:136-426) automated matches {Caulobacter crescentus [TaxId: 190650]}
acrtgvtvyghangetiedtiaeavkykamgykairlqtgvpglastygvskdkmfyepa
dndlpteniwstakylnsvpklferarevlgwdvhllhdvhhrltpieaarlgkdlepyr
lfwledsvpaenqagfrlirqhtttplavgeifahvwdakqlieeqlidylratvlhagg
itnlkkiaafadlhhvktgchgatdlspvtmaaalhfdmsitnfglqeymrhtpetdavf
phaytfsdgmlhpgdkpglgvdidedlaakhpykraylpvnrledgtmfnw

Timeline for d4gmea2:

• d4gmea2 first appeared in SCOPe 2.05
  
• d4gmea2 appears in SCOPe 2.07