SCOPe 2.08: Domain d4girc2: 4gir C:116-399

Lineage for d4girc2 (4gir C:116-399)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Vibrio harveyi [TaxId:673519] [267937] (3 PDB entries)

8. Domain d4girc2: 4gir C:116-399 [266315]
   Other proteins in same PDB: d4gira1, d4girb1, d4girb3, d4girc1, d4gird1, d4gird3
   automated match to d4ihca2
   complexed with cl, edo, mg, na, so4

Details for d4girc2

PDB Entry: 4gir, 2 Å

PDB Description: Crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group P41212)

PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d4girc2:

Sequence; same for both SEQRES and ATOM records:

>d4girc2 c.1.11.0 (C:116-399) automated matches {Vibrio harveyi [TaxId: 673519]}
ksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgsy
ydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilp
psqtewldnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklgh
fcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaeping
ylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsihtp

Timeline for d4girc2:

• d4girc2 first appeared in SCOPe 2.05
  
• d4girc2 appears in SCOPe 2.07