SCOPe 2.08: Domain d4gira1: 4gir A:3-115

Lineage for d4gira1 (4gir A:3-115)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Vibrio harveyi [TaxId:673519] [267936] (3 PDB entries)

8. Domain d4gira1: 4gir A:3-115 [266310]
   Other proteins in same PDB: d4gira2, d4girb2, d4girb3, d4girc2, d4gird2, d4gird3
   automated match to d4ihca1
   complexed with cl, edo, mg, na, so4

Details for d4gira1

PDB Entry: 4gir, 2 Å

PDB Description: Crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group P41212)

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d4gira1:

Sequence; same for both SEQRES and ATOM records:

>d4gira1 d.54.1.0 (A:3-115) automated matches {Vibrio harveyi [TaxId: 673519]}
kntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdeylkplligk
danniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfgg

Timeline for d4gira1:

• d4gira1 first appeared in SCOPe 2.05
  
• d4gira1 appears in SCOPe 2.07