Lineage for d4gghd2 (4ggh D:116-399)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837875Species Vibrio harveyi [TaxId:673519] [267937] (3 PDB entries)
  8. 2837879Domain d4gghd2: 4ggh D:116-399 [266303]
    Other proteins in same PDB: d4ggha1, d4gghb1, d4gghc1, d4gghd1
    automated match to d4ihca2
    complexed with cl, edo, epe, gol, mg

Details for d4gghd2

PDB Entry: 4ggh (more details), 1.9 Å

PDB Description: Crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, hepes, and ethylene glycol bound (ordered loops, space group c2221)
PDB Compounds: (D:) Putative uncharacterized protein

SCOPe Domain Sequences for d4gghd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gghd2 c.1.11.0 (D:116-399) automated matches {Vibrio harveyi [TaxId: 673519]}
ksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgsy
ydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilp
psqtewldnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklgh
fcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaeping
ylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsihtp

SCOPe Domain Coordinates for d4gghd2:

Click to download the PDB-style file with coordinates for d4gghd2.
(The format of our PDB-style files is described here.)

Timeline for d4gghd2: