Lineage for d1bv7b_ (1bv7 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2067644Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2067878Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (476 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 2068621Domain d1bv7b_: 1bv7 B: [26630]
    complexed with xv6; mutant

Details for d1bv7b_

PDB Entry: 1bv7 (more details), 2 Å

PDB Description: counteracting hiv-1 protease drug resistance: structural analysis of mutant proteases complexed with xv638 and sd146, cyclic urea amides with broad specificities
PDB Compounds: (B:) protein (hiv-1 protease)

SCOPe Domain Sequences for d1bv7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bv7b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfniigrnlltqigctlnf

SCOPe Domain Coordinates for d1bv7b_:

Click to download the PDB-style file with coordinates for d1bv7b_.
(The format of our PDB-style files is described here.)

Timeline for d1bv7b_: