| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Vibrio harveyi [TaxId:673519] [267936] (3 PDB entries) |
| Domain d4ggha1: 4ggh A:3-115 [266296] Other proteins in same PDB: d4ggha2, d4gghb2, d4gghc2, d4gghd2 automated match to d4ihca1 complexed with cl, edo, epe, gol, mg |
PDB Entry: 4ggh (more details), 1.9 Å
SCOPe Domain Sequences for d4ggha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ggha1 d.54.1.0 (A:3-115) automated matches {Vibrio harveyi [TaxId: 673519]}
kntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdeylkplligk
danniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfgg
Timeline for d4ggha1: