Lineage for d4g0dc2 (4g0d C:276-471)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074482Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 2074483Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 2074518Family b.66.1.0: automated matches [196610] (1 protein)
    not a true family
  6. 2074519Protein automated matches [196611] (2 species)
    not a true protein
  7. 2074520Species Human (Homo sapiens) [TaxId:9606] [196612] (6 PDB entries)
  8. 2074526Domain d4g0dc2: 4g0d C:276-471 [266292]
    Other proteins in same PDB: d4g0da1, d4g0db1, d4g0dc1, d4g0dd1
    automated match to d3ba0a2
    complexed with ca, cl, gol, peg, pgo, zn

Details for d4g0dc2

PDB Entry: 4g0d (more details), 2.54 Å

PDB Description: Human collagenase 3 (MMP-13) full form with peptides from pro-domain
PDB Compounds: (C:) collagenase 3

SCOPe Domain Sequences for d4g0dc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g0dc2 b.66.1.0 (C:276-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khpktpdkcdpslsldaitslrgetmifkdrffwrlhpqqvdaelfltksfwpelpnrid
aayehpshdlififrgrkfwalngydilegypkkiselglpkevkkisaavhfedtgktl
lfsgnqvwryddtnhimdkdyprlieedfpgigdkvdavyekngyiyffngpiqfeysiw
snrivrvmpansilwc

SCOPe Domain Coordinates for d4g0dc2:

Click to download the PDB-style file with coordinates for d4g0dc2.
(The format of our PDB-style files is described here.)

Timeline for d4g0dc2: