![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily) consists of four 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) ![]() |
![]() | Family b.66.1.0: automated matches [196610] (1 protein) not a true family |
![]() | Protein automated matches [196611] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196612] (9 PDB entries) |
![]() | Domain d4g0dc2: 4g0d C:276-471 [266292] Other proteins in same PDB: d4g0da1, d4g0db1, d4g0dc1, d4g0dd1 automated match to d3ba0a2 complexed with ca, cl, gol, peg, pgo, zn |
PDB Entry: 4g0d (more details), 2.54 Å
SCOPe Domain Sequences for d4g0dc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g0dc2 b.66.1.0 (C:276-471) automated matches {Human (Homo sapiens) [TaxId: 9606]} khpktpdkcdpslsldaitslrgetmifkdrffwrlhpqqvdaelfltksfwpelpnrid aayehpshdlififrgrkfwalngydilegypkkiselglpkevkkisaavhfedtgktl lfsgnqvwryddtnhimdkdyprlieedfpgigdkvdavyekngyiyffngpiqfeysiw snrivrvmpansilwc
Timeline for d4g0dc2: