![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein Collagenase-3 (MMP-13) [55540] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55541] (45 PDB entries) |
![]() | Domain d4g0dc1: 4g0d C:104-275 [266291] Other proteins in same PDB: d4g0da2, d4g0db2, d4g0dc2, d4g0dd2 automated match to d3ba0a1 complexed with ca, cl, gol, peg, pgo, zn |
PDB Entry: 4g0d (more details), 2.54 Å
SCOPe Domain Sequences for d4g0dc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g0dc1 d.92.1.11 (C:104-275) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaaha fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgdedpnp
Timeline for d4g0dc1: