SCOP 1.61: Domain d1bv7a_: 1bv7 A:

Lineage for d1bv7a_ (1bv7 A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (141 PDB entries)

8. Domain d1bv7a_: 1bv7 A: [26629]

Details for d1bv7a_

PDB Entry: 1bv7, 2 Å

PDB Description: counteracting hiv-1 protease drug resistance: structural analysis of mutant proteases complexed with xv638 and sd146, cyclic urea amides with broad specificities

SCOP Domain Sequences for d1bv7a_:

Sequence; same for both SEQRES and ATOM records:

>d1bv7a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfniigrnlltqigctlnf

Timeline for d1bv7a_:

• d1bv7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1bv7a_ appears in SCOP 1.59
  
• d1bv7a_ appears in SCOP 1.63
  
• d1bv7a_ appears in the current release, SCOPe 2.08