SCOP 1.63: Domain d1a8ke_: 1a8k E:

Lineage for d1a8ke_ (1a8k E:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (151 PDB entries)

8. Domain d1a8ke_: 1a8k E: [26628]
   complexed with nh2; mutant

Details for d1a8ke_

PDB Entry: 1a8k, 2 Å

PDB Description: crystallographic analysis of human immunodeficiency virus 1 protease with an analog of the conserved ca-p2 substrate: interactions with frequently occurring glutamic acid residue at p2' position of substrates

SCOP Domain Sequences for d1a8ke_:

Sequence; same for both SEQRES and ATOM records:

>d1a8ke_ b.50.1.1 (E:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1a8ke_:

• d1a8ke_ first appeared (with stable ids) in SCOP 1.55
  
• d1a8ke_ appears in SCOP 1.61
  
• d1a8ke_ appears in SCOP 1.65
  
• d1a8ke_ appears in the current release, SCOPe 2.08