Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (36 PDB entries) |
Domain d4fyqa2: 4fyq A:288-548 [266276] Other proteins in same PDB: d4fyqa1, d4fyqa3, d4fyqa4 automated match to d4p8qa2 complexed with acy, nag, so4, zn |
PDB Entry: 4fyq (more details), 1.9 Å
SCOPe Domain Sequences for d4fyqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fyqa2 d.92.1.0 (A:288-548) automated matches {Human (Homo sapiens) [TaxId: 9606]} dyvekqasngvliriwarpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglp dfnagamenwglvtyrensllfdplsssssnkervvtviahelahqwfgnlvtiewwndl wlnegfasyveylgadyaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaq iselfdaisyskgasvlrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnn rsiqlpttvrdimnrwtlqmg
Timeline for d4fyqa2: