Lineage for d4fyqa2 (4fyq A:288-548)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (57 PDB entries)
  8. 2530253Domain d4fyqa2: 4fyq A:288-548 [266276]
    Other proteins in same PDB: d4fyqa1, d4fyqa3, d4fyqa4
    automated match to d4p8qa2
    complexed with acy, bma, nag, so4, zn

Details for d4fyqa2

PDB Entry: 4fyq (more details), 1.9 Å

PDB Description: human aminopeptidase n (cd13)
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4fyqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fyqa2 d.92.1.0 (A:288-548) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyvekqasngvliriwarpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglp
dfnagamenwglvtyrensllfdplsssssnkervvtviahelahqwfgnlvtiewwndl
wlnegfasyveylgadyaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaq
iselfdaisyskgasvlrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnn
rsiqlpttvrdimnrwtlqmg

SCOPe Domain Coordinates for d4fyqa2:

Click to download the PDB-style file with coordinates for d4fyqa2.
(The format of our PDB-style files is described here.)

Timeline for d4fyqa2: