SCOPe 2.06: Domain d4fvlb2: 4fvl B:276-471

Lineage for d4fvlb2 (4fvl B:276-471)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (2 families)

5. Family b.66.1.0: automated matches [196610] (1 protein)
   not a true family

6. Protein automated matches [196611] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196612] (6 PDB entries)

8. Domain d4fvlb2: 4fvl B:276-471 [266274]
   Other proteins in same PDB: d4fvla1, d4fvlb1
   automated match to d3ba0a2
   complexed with ca, cl, gol, peg, pgo, zn

Details for d4fvlb2

PDB Entry: 4fvl, 2.44 Å

PDB Description: Human collagenase 3 (MMP-13) full form with peptides from pro-domain

PDB Compounds: (B:) collagenase 3

SCOPe Domain Sequences for d4fvlb2:

Sequence; same for both SEQRES and ATOM records:

>d4fvlb2 b.66.1.0 (B:276-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khpktpdkcdpslsldaitslrgetmifkdrffwrlhpqqvdaelfltksfwpelpnrid
aayehpshdlififrgrkfwalngydilegypkkiselglpkevkkisaavhfedtgktl
lfsgnqvwryddtnhimdkdyprlieedfpgigdkvdavyekngyiyffngpiqfeysiw
snrivrvmpansilwc

Timeline for d4fvlb2:

• d4fvlb2 first appeared in SCOPe 2.05
  
• d4fvlb2 appears in SCOPe 2.07
  
• d4fvlb2 appears in the current release, SCOPe 2.08