![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein Collagenase-3 (MMP-13) [55540] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55541] (47 PDB entries) |
![]() | Domain d4fvlb1: 4fvl B:104-275 [266273] Other proteins in same PDB: d4fvla2, d4fvlb2 automated match to d3ba0a1 complexed with ca, cl, gol, peg, pgo, zn |
PDB Entry: 4fvl (more details), 2.44 Å
SCOPe Domain Sequences for d4fvlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fvlb1 d.92.1.11 (B:104-275) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaaha fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgdedpnp
Timeline for d4fvlb1: